PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B00373.1.p
Common NameEUGRSUZ_B00373
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 222aa    MW: 25364.6 Da    PI: 9.6413
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B00373.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.4e-191057148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g WT+eEd ll+d+v+ +G+g W++I+++ g++R++k+c++rw +yl
  Eucgr.B00373.1.p 10 KGLWTAEEDRLLADYVRVHGKGKWNRIPQMTGLKRCGKSCRLRWMNYL 57
                      678*******************************************97 PP

2Myb_DNA-binding60.14.7e-1963108148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg +++eEd+l+++++++lG++ W++Ia +++ gRt++q+k++w+++l
  Eucgr.B00373.1.p  63 RGDFSEEEDDLIIRLHNLLGNR-WSLIAGRVP-GRTDNQVKNHWNTHL 108
                       899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.866557IPR017930Myb domain
SuperFamilySSF466892.4E-318104IPR009057Homeodomain-like
SMARTSM007173.0E-14959IPR001005SANT/Myb domain
PfamPF002494.8E-171057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-231164IPR009057Homeodomain-like
CDDcd001671.59E-111357No hitNo description
PROSITE profilePS5129428.20258112IPR017930Myb domain
SMARTSM007175.1E-1862110IPR001005SANT/Myb domain
PfamPF002497.5E-1863108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2665112IPR009057Homeodomain-like
CDDcd001675.38E-1366108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MKGEKKEHRK GLWTAEEDRL LADYVRVHGK GKWNRIPQMT GLKRCGKSCR LRWMNYLSPS  60
VKRGDFSEEE DDLIIRLHNL LGNRWSLIAG RVPGRTDNQV KNHWNTHLSK RLGLKKGKGR  120
ADDHRPRTHL KKEKENHAMV LGSSLEPPSS DHLEETARKI TGDDKSSRGA LVECDSSQQL  180
ATPSNEFQNP FWFFNSDLNL YSPDFTDRLG EYALDLVSDG L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27101127108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B00373.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4795420.0AB479542.1 Eucalyptus grandis mRNA for transcription factor Myb, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289651.11e-162transcription factor WER-like
SwissprotQ9SEI08e-64WER_ARATH; Transcription factor WER
TrEMBLA0A059CZ391e-164A0A059CZ39_EUCGR; Uncharacterized protein
STRINGVIT_17s0000g08480.t016e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.12e-61myb domain protein 66